Brand: | Abnova |
Reference: | H00010063-M03 |
Product name: | COX17 monoclonal antibody (M03), clone 1A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COX17. |
Clone: | 1A9 |
Isotype: | IgG2a Kappa |
Gene id: | 10063 |
Gene name: | COX17 |
Gene alias: | MGC104397|MGC117386 |
Gene description: | COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) |
Genbank accession: | NM_005694 |
Immunogen: | COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI |
Protein accession: | NP_005685 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged COX17 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |