SLC17A4 monoclonal antibody (M03), clone 3E4 View larger

SLC17A4 monoclonal antibody (M03), clone 3E4

H00010050-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC17A4 monoclonal antibody (M03), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SLC17A4 monoclonal antibody (M03), clone 3E4

Brand: Abnova
Reference: H00010050-M03
Product name: SLC17A4 monoclonal antibody (M03), clone 3E4
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC17A4.
Clone: 3E4
Isotype: IgG1 Kappa
Gene id: 10050
Gene name: SLC17A4
Gene alias: KAIA2138|KIAA2138|MGC129623
Gene description: solute carrier family 17 (sodium phosphate), member 4
Genbank accession: NM_005495
Immunogen: SLC17A4 (NP_005486.1, 56 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV
Protein accession: NP_005486.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010050-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010050-M03-1-9-1.jpg
Application image note: SLC17A4 monoclonal antibody (M03), clone 3E4. Western Blot analysis of SLC17A4 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC17A4 monoclonal antibody (M03), clone 3E4 now

Add to cart