H00010050-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010050-M03 |
Product name: | SLC17A4 monoclonal antibody (M03), clone 3E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC17A4. |
Clone: | 3E4 |
Isotype: | IgG1 Kappa |
Gene id: | 10050 |
Gene name: | SLC17A4 |
Gene alias: | KAIA2138|KIAA2138|MGC129623 |
Gene description: | solute carrier family 17 (sodium phosphate), member 4 |
Genbank accession: | NM_005495 |
Immunogen: | SLC17A4 (NP_005486.1, 56 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV |
Protein accession: | NP_005486.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SLC17A4 monoclonal antibody (M03), clone 3E4. Western Blot analysis of SLC17A4 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |