MAMLD1 monoclonal antibody (M01), clone 4B4 View larger

MAMLD1 monoclonal antibody (M01), clone 4B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAMLD1 monoclonal antibody (M01), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MAMLD1 monoclonal antibody (M01), clone 4B4

Brand: Abnova
Reference: H00010046-M01
Product name: MAMLD1 monoclonal antibody (M01), clone 4B4
Product description: Mouse monoclonal antibody raised against a partial recombinant MAMLD1.
Clone: 4B4
Isotype: IgG1 Kappa
Gene id: 10046
Gene name: MAMLD1
Gene alias: CG1|CXorf6|F18
Gene description: mastermind-like domain containing 1
Genbank accession: NM_005491
Immunogen: MAMLD1 (NP_005482, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
Protein accession: NP_005482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010046-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010046-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MAMLD1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAMLD1 monoclonal antibody (M01), clone 4B4 now

Add to cart