SH2D3C monoclonal antibody (M07), clone 3C5 View larger

SH2D3C monoclonal antibody (M07), clone 3C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH2D3C monoclonal antibody (M07), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SH2D3C monoclonal antibody (M07), clone 3C5

Brand: Abnova
Reference: H00010044-M07
Product name: SH2D3C monoclonal antibody (M07), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant SH2D3C.
Clone: 3C5
Isotype: IgG1 Kappa
Gene id: 10044
Gene name: SH2D3C
Gene alias: CHAT|FLJ39664|NSP3|PRO34088
Gene description: SH2 domain containing 3C
Genbank accession: NM_005489
Immunogen: SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI
Protein accession: NP_005480
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010044-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010044-M07-1-25-1.jpg
Application image note: SH2D3C monoclonal antibody (M07), clone 3C5 Western Blot analysis of SH2D3C expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SH2D3C monoclonal antibody (M07), clone 3C5 now

Add to cart