Brand: | Abnova |
Reference: | H00010044-M02 |
Product name: | SH2D3C monoclonal antibody (M02), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SH2D3C. |
Clone: | 2E3 |
Isotype: | IgG1 kappa |
Gene id: | 10044 |
Gene name: | SH2D3C |
Gene alias: | CHAT|FLJ39664|NSP3|PRO34088 |
Gene description: | SH2 domain containing 3C |
Genbank accession: | NM_005489 |
Immunogen: | SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI |
Protein accession: | NP_005480 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SH2D3C is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |