Brand: | Abnova |
Reference: | H00010042-M01 |
Product name: | HMG2L1 monoclonal antibody (M01), clone 3B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HMG2L1. |
Clone: | 3B4 |
Isotype: | IgG1 Kappa |
Gene id: | 10042 |
Gene name: | HMGXB4 |
Gene alias: | HMG2L1|HMGBCG|THC211630 |
Gene description: | HMG box domain containing 4 |
Genbank accession: | NM_001003681 |
Immunogen: | HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK |
Protein accession: | NP_001003681 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |