Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHAF1A (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about CHAF1A (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00010036-Q01 |
| Product name: | CHAF1A (Human) Recombinant Protein (Q01) |
| Product description: | Human CHAF1A partial ORF ( AAH67093, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 10036 |
| Gene name: | CHAF1A |
| Gene alias: | CAF-1|CAF1|CAF1B|CAF1P150|MGC71229|P150 |
| Gene description: | chromatin assembly factor 1, subunit A (p150) |
| Genbank accession: | BC067093 |
| Immunogen sequence/protein sequence: | CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT |
| Protein accession: | AAH67093 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.Doe K, Nozawa K, Hiruma K, Yamada Y, Matsuki Y, Nakano S, Ogasawara M, Nakano H, Ikeda T, Ikegami T, Fujishiro M, Kawasaki M, Ikeda K, Amano H, Morimoto S, Ogawa H, Takamori K, Sekigawa I, Takasaki Y Lupus. 2014 May 16. pii: 0961203314536245. |