Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHAF1A monoclonal antibody (M02), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CHAF1A monoclonal antibody (M02), clone 1C2
| Brand: | Abnova |
| Reference: | H00010036-M02 |
| Product name: | CHAF1A monoclonal antibody (M02), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHAF1A. |
| Clone: | 1C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10036 |
| Gene name: | CHAF1A |
| Gene alias: | CAF-1|CAF1|CAF1B|CAF1P150|MGC71229|P150 |
| Gene description: | chromatin assembly factor 1, subunit A (p150) |
| Genbank accession: | BC067093 |
| Immunogen: | CHAF1A (AAH67093, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT |
| Protein accession: | AAH67093 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CHAF1A monoclonal antibody (M02), clone 1C2 Western Blot analysis of CHAF1A expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.Doe K, Nozawa K, Hiruma K, Yamada Y, Matsuki Y, Nakano S, Ogasawara M, Nakano H, Ikeda T, Ikegami T, Fujishiro M, Kawasaki M, Ikeda K, Amano H, Morimoto S, Ogawa H, Takamori K, Sekigawa I, Takasaki Y Lupus. 2014 May 16. pii: 0961203314536245. |