Brand: | Abnova |
Reference: | H00010025-M02 |
Product name: | THRAP5 monoclonal antibody (M02), clone 2B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant THRAP5. |
Clone: | 2B7 |
Isotype: | IgG2b Kappa |
Gene id: | 10025 |
Gene name: | MED16 |
Gene alias: | DRIP92|THRAP5|TRAP95 |
Gene description: | mediator complex subunit 16 |
Genbank accession: | BC017282 |
Immunogen: | THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM |
Protein accession: | AAH17282 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to THRAP5 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |