HCN4 monoclonal antibody (M04), clone 2A5 View larger

HCN4 monoclonal antibody (M04), clone 2A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HCN4 monoclonal antibody (M04), clone 2A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HCN4 monoclonal antibody (M04), clone 2A5

Brand: Abnova
Reference: H00010021-M04
Product name: HCN4 monoclonal antibody (M04), clone 2A5
Product description: Mouse monoclonal antibody raised against a partial recombinant HCN4.
Clone: 2A5
Isotype: IgG2a Kappa
Gene id: 10021
Gene name: HCN4
Gene alias: -
Gene description: hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Genbank accession: NM_005477
Immunogen: HCN4 (NP_005468.1, 1105 a.a. ~ 1203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL
Protein accession: NP_005468.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010021-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010021-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HCN4 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HCN4 monoclonal antibody (M04), clone 2A5 now

Add to cart