Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HDAC6 monoclonal antibody (M01), clone 1E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HDAC6 monoclonal antibody (M01), clone 1E2
| Brand: | Abnova |
| Reference: | H00010013-M01 |
| Product name: | HDAC6 monoclonal antibody (M01), clone 1E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HDAC6. |
| Clone: | 1E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10013 |
| Gene name: | HDAC6 |
| Gene alias: | FLJ16239|HD6|JM21 |
| Gene description: | histone deacetylase 6 |
| Genbank accession: | NM_006044 |
| Immunogen: | HDAC6 (NP_006035, 1128 a.a. ~ 1215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH |
| Protein accession: | NP_006035 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HDAC6 monoclonal antibody (M01), clone 1E2 Western Blot analysis of HDAC6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.Bantscheff M, Hopf C, Savitski MM, Dittmann A, Grandi P, Michon AM, Schlegl J, Abraham Y, Becher I, Bergamini G, Boesche M, Delling M, Dumpelfeld B, Eberhard D, Huthmacher C, Mathieson T, Poeckel D, Reader V, Strunk K, Sweetman G, Kruse U, Neubauer G, Ramsden NG, Drewes G. Nat Biotechnol. 2011 Jan 23. [Epub ahead of print] |