ZBTB33 monoclonal antibody (M02), clone 3A8 View larger

ZBTB33 monoclonal antibody (M02), clone 3A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB33 monoclonal antibody (M02), clone 3A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZBTB33 monoclonal antibody (M02), clone 3A8

Brand: Abnova
Reference: H00010009-M02
Product name: ZBTB33 monoclonal antibody (M02), clone 3A8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
Clone: 3A8
Isotype: IgG2a Kappa
Gene id: 10009
Gene name: ZBTB33
Gene alias: ZNF-kaiso|ZNF348
Gene description: zinc finger and BTB domain containing 33
Genbank accession: BC042753
Immunogen: ZBTB33 (AAH42753, 564 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Protein accession: AAH42753
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010009-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010009-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZBTB33 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZBTB33 monoclonal antibody (M02), clone 3A8 now

Add to cart