NR2E3 monoclonal antibody (M01), clone 2A12 View larger

NR2E3 monoclonal antibody (M01), clone 2A12

H00010002-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR2E3 monoclonal antibody (M01), clone 2A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NR2E3 monoclonal antibody (M01), clone 2A12

Brand: Abnova
Reference: H00010002-M01
Product name: NR2E3 monoclonal antibody (M01), clone 2A12
Product description: Mouse monoclonal antibody raised against a full length recombinant NR2E3.
Clone: 2A12
Isotype: IgG1
Gene id: 10002
Gene name: NR2E3
Gene alias: ESCS|MGC49976|PNR|RNR|RP37|rd7
Gene description: nuclear receptor subfamily 2, group E, member 3
Genbank accession: BC041421
Immunogen: NR2E3 (AAH41421, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Protein accession: AAH41421
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010002-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (61.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010002-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NR2E3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NR2E3 monoclonal antibody (M01), clone 2A12 now

Add to cart