Brand: | Abnova |
Reference: | H00010000-M07 |
Product name: | AKT3 monoclonal antibody (M07), clone 6F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT3. |
Clone: | 6F12 |
Isotype: | IgG2a Kappa |
Gene id: | 10000 |
Gene name: | AKT3 |
Gene alias: | DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2 |
Gene description: | v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
Genbank accession: | AF124141 |
Immunogen: | AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE |
Protein accession: | AAD29089 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00010000-M07-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00010000-M07-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00010000-M07-1-1-1.jpg](http://www.abnova.com/application_image/H00010000-M07-1-1-1.jpg) |
Application image note: | AKT3 monoclonal antibody (M07), clone 6F12 Western Blot analysis of AKT3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |