AKT3 monoclonal antibody (M01), clone 2F3 View larger

AKT3 monoclonal antibody (M01), clone 2F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKT3 monoclonal antibody (M01), clone 2F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about AKT3 monoclonal antibody (M01), clone 2F3

Brand: Abnova
Reference: H00010000-M01
Product name: AKT3 monoclonal antibody (M01), clone 2F3
Product description: Mouse monoclonal antibody raised against a partial recombinant AKT3.
Clone: 2F3
Isotype: IgG2a Kappa
Gene id: 10000
Gene name: AKT3
Gene alias: DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2
Gene description: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Genbank accession: AF124141
Immunogen: AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Protein accession: AAD29089
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010000-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010000-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged AKT3 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AKT3 monoclonal antibody (M01), clone 2F3 now

Add to cart