Brand: | Abnova |
Reference: | H00009991-M01 |
Product name: | ROD1 monoclonal antibody (M01), clone 4C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ROD1. |
Clone: | 4C9 |
Isotype: | IgG1 Kappa |
Gene id: | 9991 |
Gene name: | ROD1 |
Gene alias: | DKFZp781I1117|PTBP3 |
Gene description: | ROD1 regulator of differentiation 1 (S. pombe) |
Genbank accession: | NM_005156 |
Immunogen: | ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY |
Protein accession: | NP_005147 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009991-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009991-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00009991-M01-3-36-1-L.jpg](http://www.abnova.com/application_image/H00009991-M01-3-36-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |