Brand: | Abnova |
Reference: | H00009986-M06 |
Product name: | RCE1 monoclonal antibody (M06), clone 6A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RCE1. |
Clone: | 6A6 |
Isotype: | IgG2a Kappa |
Gene id: | 9986 |
Gene name: | RCE1 |
Gene alias: | FACE2|RCE1A|RCE1B |
Gene description: | RCE1 homolog, prenyl protein peptidase (S. cerevisiae) |
Genbank accession: | NM_005133 |
Immunogen: | RCE1 (NP_005124, 133 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC |
Protein accession: | NP_005124 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |