CCS monoclonal antibody (M03), clone 1E2 View larger

CCS monoclonal antibody (M03), clone 1E2

H00009973-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCS monoclonal antibody (M03), clone 1E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CCS monoclonal antibody (M03), clone 1E2

Brand: Abnova
Reference: H00009973-M03
Product name: CCS monoclonal antibody (M03), clone 1E2
Product description: Mouse monoclonal antibody raised against a partial recombinant CCS.
Clone: 1E2
Isotype: IgG1 Kappa
Gene id: 9973
Gene name: CCS
Gene alias: MGC138260
Gene description: copper chaperone for superoxide dismutase
Genbank accession: NM_005125
Immunogen: CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Protein accession: NP_005116
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009973-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009973-M03-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Impaired Copper and Iron Metabolism in Blood Cells and Muscles of Patients Affected by Copper Deficiency Myeloneuropathy.Spinazzi M, Sghirlanzoni A, Salviati L, Angelini C.
Neuropathol Appl Neurobiol. 2014 Dec;40(7):888-98.

Reviews

Buy CCS monoclonal antibody (M03), clone 1E2 now

Add to cart