Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR1H4 monoclonal antibody (M02), clone 1B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about NR1H4 monoclonal antibody (M02), clone 1B10
| Brand: | Abnova |
| Reference: | H00009971-M02 |
| Product name: | NR1H4 monoclonal antibody (M02), clone 1B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR1H4. |
| Clone: | 1B10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9971 |
| Gene name: | NR1H4 |
| Gene alias: | BAR|FXR|HRR-1|HRR1|MGC163445|RIP14 |
| Gene description: | nuclear receptor subfamily 1, group H, member 4 |
| Genbank accession: | NM_005123 |
| Immunogen: | NR1H4 (NP_005114, 363 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ |
| Protein accession: | NP_005114 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to NR1H4 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Binding of hepatitis B virus to its cellular receptor alters the expression profile of genes of the bile acid metabolism.Oehler N, Volz T, Bhadra OD, Kah J, Allweiss L, Giersch K, Bierwolf J, Riecken K, Pollok JM, Lohse AW, Fehse B, Petersen J, Urban S, Lutgehetmann M, Heeren J, Dandri M Hepatology. 2014 Nov;60(5):1483-93. doi: 10.1002/hep.27159. Epub 2014 May 19. |