Brand: | Abnova |
Reference: | H00009966-M07 |
Product name: | TNFSF15 monoclonal antibody (M07), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF15. |
Clone: | 2E3 |
Isotype: | IgG1 Kappa |
Gene id: | 9966 |
Gene name: | TNFSF15 |
Gene alias: | MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A |
Gene description: | tumor necrosis factor (ligand) superfamily, member 15 |
Genbank accession: | BC074941.2 |
Immunogen: | TNFSF15 (AAH74941.1, 72 a.a. ~ 251 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Protein accession: | AAH74941.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |