Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF19 monoclonal antibody (M01), clone 4C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about FGF19 monoclonal antibody (M01), clone 4C4
| Brand: | Abnova |
| Reference: | H00009965-M01 |
| Product name: | FGF19 monoclonal antibody (M01), clone 4C4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FGF19. |
| Clone: | 4C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9965 |
| Gene name: | FGF19 |
| Gene alias: | - |
| Gene description: | fibroblast growth factor 19 |
| Genbank accession: | BC017664 |
| Immunogen: | FGF19 (AAH17664, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Protein accession: | AAH17664 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (49.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FGF19 expression in transfected 293T cell line by FGF19 monoclonal antibody (M01), clone 4C4. Lane 1: FGF19 transfected lysate (Predicted MW: 24 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | FGF15/19 protein levels in the portal blood do not reflect changes in the ileal FGF15/19 or hepatic CYP7A1 mRNA levels.Shang Q, Guo GL, Honda A, Saumoy M, Salen G, Xu G J Lipid Res. 2013 Oct;54(10):2606-14. doi: 10.1194/jlr.M034827. Epub 2013 Jul 12. |