Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009960-M01 |
Product name: | USP3 monoclonal antibody (M01), clone 1H2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP3. |
Clone: | 1H2 |
Isotype: | IgG2a Kappa |
Gene id: | 9960 |
Gene name: | USP3 |
Gene alias: | MGC129878|MGC129879|SIH003|UBP |
Gene description: | ubiquitin specific peptidase 3 |
Genbank accession: | NM_006537 |
Immunogen: | USP3 (NP_006528, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL |
Protein accession: | NP_006528 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of USP3 expression in transfected 293T cell line by USP3 monoclonal antibody (M01), clone 1H2. Lane 1: USP3 transfected lysate(58.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | The Deubiquitylating Enzyme USP44 Counteracts the DNA Double-strand Break Response Mediated by the RNF8 and RNF168 Ubiquitin Ligases.Mosbech A, Lukas C, Bekker-Jensen S, Mailand N J Biol Chem. 2013 Jun 7;288(23):16579-87. doi: 10.1074/jbc.M113.459917. Epub 2013 Apr 24. |