Brand: | Abnova |
Reference: | H00009958-M01 |
Product name: | USP15 monoclonal antibody (M01), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant USP15. |
Clone: | 1C10 |
Isotype: | IgG1 kappa |
Gene id: | 9958 |
Gene name: | USP15 |
Gene alias: | KIAA0529|MGC131982|MGC149838|MGC74854|UNPH4 |
Gene description: | ubiquitin specific peptidase 15 |
Genbank accession: | BC020688 |
Immunogen: | USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC |
Protein accession: | AAH20688 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009958-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009958-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (51.59 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009958-M01-4-1-1-L.jpg](http://www.abnova.com/application_image/H00009958-M01-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.Xu M, Takanashi M, Oikawa K, Tanaka M, Nishi H, Isaka K, Kudo M, Kuroda M. Biochem Biophys Res Commun. 2009 Oct 16;388(2):366-71. Epub 2009 Aug 8. |