Brand: | Abnova |
Reference: | H00009956-M01 |
Product name: | HS3ST2 monoclonal antibody (M01), clone 5D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HS3ST2. |
Clone: | 5D5 |
Isotype: | IgG2a Kappa |
Gene id: | 9956 |
Gene name: | HS3ST2 |
Gene alias: | 30ST2|3OST2 |
Gene description: | heparan sulfate (glucosamine) 3-O-sulfotransferase 2 |
Genbank accession: | NM_006043 |
Immunogen: | HS3ST2 (NP_006034, 268 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE |
Protein accession: | NP_006034 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HS3ST2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |