Brand: | Abnova |
Reference: | H00009950-M01 |
Product name: | GOLGA5 monoclonal antibody (M01), clone 6B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GOLGA5. |
Clone: | 6B3 |
Isotype: | IgG2a Kappa |
Gene id: | 9950 |
Gene name: | GOLGA5 |
Gene alias: | GOLIM5|RFG5|ret-II |
Gene description: | golgi autoantigen, golgin subfamily a, 5 |
Genbank accession: | NM_005113 |
Immunogen: | GOLGA5 (NP_005104, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVE |
Protein accession: | NP_005104 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009950-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009950-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009950-M01-1-9-1.jpg](http://www.abnova.com/application_image/H00009950-M01-1-9-1.jpg) |
Application image note: | GOLGA5 monoclonal antibody (M01), clone 6B3 Western Blot analysis of GOLGA5 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |