Brand: | Abnova |
Reference: | H00009943-M09 |
Product name: | OXSR1 monoclonal antibody (M09), clone 5D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
Clone: | 5D5 |
Isotype: | IgG3 Kappa |
Gene id: | 9943 |
Gene name: | OXSR1 |
Gene alias: | KIAA1101|OSR1 |
Gene description: | oxidative-stress responsive 1 |
Genbank accession: | BC008726.1 |
Immunogen: | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
Protein accession: | AAH08726.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009943-M09-1-1-1.jpg](http://www.abnova.com/application_image/H00009943-M09-1-1-1.jpg) |
Application image note: | OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |
Publications: | Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression.Trudu M, Janas S, Lanzani C, Debaix H, Schaeffer C, Ikehata M, Citterio L, Demaretz S, Trevisani F, Ristagno G, Glaudemans B, Laghmani K Nat Med. 2013 Dec;19(12):1655-60. doi: 10.1038/nm.3384. Epub 2013 Nov 3. |