Brand: | Abnova |
Reference: | H00009943-M06 |
Product name: | OXSR1 monoclonal antibody (M06), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
Clone: | 1C8 |
Isotype: | IgG3 Kappa |
Gene id: | 9943 |
Gene name: | OXSR1 |
Gene alias: | KIAA1101|OSR1 |
Gene description: | oxidative-stress responsive 1 |
Genbank accession: | BC008726.1 |
Immunogen: | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
Protein accession: | AAH08726.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009943-M06-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009943-M06-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009943-M06-1-1-1.jpg](http://www.abnova.com/application_image/H00009943-M06-1-1-1.jpg) |
Application image note: | OXSR1 monoclonal antibody (M06), clone 1C8 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | ASK3 responds to osmotic stress and regulates blood pressure by suppressing WNK1-SPAK/OSR1 signaling in the kidney.Naguro I, Umeda T, Kobayashi Y, Maruyama J, Hattori K, Shimizu Y, Kataoka K, Kim-Mitsuyama S, Uchida S, Vandewalle A, Noguchi T, Nishitoh H, Matsuzawa A, Takeda K, Ichijo H. Nat Commun. 2012 Dec 18;3:1285. doi: 10.1038/ncomms2283. |