Brand: | Abnova |
Reference: | H00009941-M02 |
Product name: | ENDOGL1 monoclonal antibody (M02), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENDOGL1. |
Clone: | 2F7 |
Isotype: | IgG2a Kappa |
Gene id: | 9941 |
Gene name: | EXOG |
Gene alias: | ENDOGL1|ENDOGL2|ENGL|ENGL-B|ENGL-a|MGC125944|MGC125945 |
Gene description: | endo/exonuclease (5'-3'), endonuclease G-like |
Genbank accession: | NM_005107 |
Immunogen: | ENDOGL1 (NP_005098.1, 269 a.a. ~ 368 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS |
Protein accession: | NP_005098.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009941-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009941-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00009941-M02-1-12-1.jpg](http://www.abnova.com/application_image/H00009941-M02-1-12-1.jpg) |
Application image note: | ENDOGL1 monoclonal antibody (M02), clone 2F7. Western Blot analysis of ENDOGL1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |