Brand: | Abnova |
Reference: | H00009939-M08 |
Product name: | RBM8A monoclonal antibody (M08), clone 3E4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RBM8A. |
Clone: | 3E4 |
Isotype: | IgG2b Kappa |
Gene id: | 9939 |
Gene name: | RBM8A |
Gene alias: | BOV-1A|BOV-1B|BOV-1C|MDS014|RBM8|RBM8B|Y14|ZNRP|ZRNP1 |
Gene description: | RNA binding motif protein 8A |
Genbank accession: | BC017088 |
Immunogen: | RBM8A (AAH17088, 1 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR |
Protein accession: | AAH17088 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009939-M08-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009939-M08-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (44.88 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009939-M08-3-2-1-L.jpg](http://www.abnova.com/application_image/H00009939-M08-3-2-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to RBM8A on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |