Brand: | Abnova |
Reference: | H00009927-M07 |
Product name: | MFN2 monoclonal antibody (M07), clone 4F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MFN2. |
Clone: | 4F5 |
Isotype: | IgG2a Kappa |
Gene id: | 9927 |
Gene name: | MFN2 |
Gene alias: | CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF |
Gene description: | mitofusin 2 |
Genbank accession: | NM_014874 |
Immunogen: | MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Protein accession: | NP_055689 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MFN2 monoclonal antibody (M07), clone 4F5. Western Blot analysis of MFN2 expression in human kidney. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |