MFN2 monoclonal antibody (M03), clone 4H8 View larger

MFN2 monoclonal antibody (M03), clone 4H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFN2 monoclonal antibody (M03), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about MFN2 monoclonal antibody (M03), clone 4H8

Brand: Abnova
Reference: H00009927-M03
Product name: MFN2 monoclonal antibody (M03), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant MFN2.
Clone: 4H8
Isotype: IgG2a Kappa
Gene id: 9927
Gene name: MFN2
Gene alias: CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF
Gene description: mitofusin 2
Genbank accession: NM_014874
Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Protein accession: NP_055689
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009927-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00009927-M03-3-3-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Twenty-eight days of exposure to 3,454 m increases mitochondrial volume density in human skeletal muscle.Jacobs RA, Lundby AM, Fenk S, Gehrig S, Siebenmann C, Fluck D, Kirk N, Hilty MP, Lundby C.
J Physiol. 2015 Sep 4. [Epub ahead of print]

Reviews

Buy MFN2 monoclonal antibody (M03), clone 4H8 now

Add to cart