MFN2 monoclonal antibody (M01), clone 6A8 View larger

MFN2 monoclonal antibody (M01), clone 6A8

H00009927-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFN2 monoclonal antibody (M01), clone 6A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA

More info about MFN2 monoclonal antibody (M01), clone 6A8

Brand: Abnova
Reference: H00009927-M01
Product name: MFN2 monoclonal antibody (M01), clone 6A8
Product description: Mouse monoclonal antibody raised against a partial recombinant MFN2.
Clone: 6A8
Isotype: IgG2a Kappa
Gene id: 9927
Gene name: MFN2
Gene alias: CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF
Gene description: mitofusin 2
Genbank accession: NM_014874
Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Protein accession: NP_055689
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00009927-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Mitochondrial and metabolic dysfunction in renal convoluted tubules of obese mice: protective role of melatonin.Stacchiotti A, Favero G, Giugno L, Lavazza A, Reiter RJ, Rodella LF, Rezzani R
PLoS One. 2014 Oct 27;9(10):e111141. doi: 10.1371/journal.pone.0111141. eCollection 2014.

Reviews

Buy MFN2 monoclonal antibody (M01), clone 6A8 now

Add to cart