Brand: | Abnova |
Reference: | H00009927-M01 |
Product name: | MFN2 monoclonal antibody (M01), clone 6A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MFN2. |
Clone: | 6A8 |
Isotype: | IgG2a Kappa |
Gene id: | 9927 |
Gene name: | MFN2 |
Gene alias: | CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF |
Gene description: | mitofusin 2 |
Genbank accession: | NM_014874 |
Immunogen: | MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Protein accession: | NP_055689 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00009927-M01-3-2-1-L.jpg](http://www.abnova.com/application_image/H00009927-M01-3-2-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Mitochondrial and metabolic dysfunction in renal convoluted tubules of obese mice: protective role of melatonin.Stacchiotti A, Favero G, Giugno L, Lavazza A, Reiter RJ, Rodella LF, Rezzani R PLoS One. 2014 Oct 27;9(10):e111141. doi: 10.1371/journal.pone.0111141. eCollection 2014. |