Brand: | Abnova |
Reference: | H00009924-M01 |
Product name: | USP52 monoclonal antibody (M01), clone 6A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP52. |
Clone: | 6A7 |
Isotype: | IgG1 Kappa |
Gene id: | 9924 |
Gene name: | PAN2 |
Gene alias: | FLJ39360|KIAA0710|USP52|hPAN2 |
Gene description: | PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae) |
Genbank accession: | NM_014871 |
Immunogen: | USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL |
Protein accession: | NP_055686 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009924-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009924-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged USP52 is approximately 30ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |