Brand: | Abnova |
Reference: | H00009918-M02 |
Product name: | CNAP1 monoclonal antibody (M02), clone 4C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CNAP1. |
Clone: | 4C9 |
Isotype: | IgG1 Kappa |
Gene id: | 9918 |
Gene name: | NCAPD2 |
Gene alias: | CAP-D2|CNAP1|KIAA0159|hCAP-D2 |
Gene description: | non-SMC condensin I complex, subunit D2 |
Genbank accession: | BC028182 |
Immunogen: | CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT |
Protein accession: | AAH28182 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |