Brand: | Abnova |
Reference: | H00009915-M03 |
Product name: | ARNT2 monoclonal antibody (M03), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARNT2. |
Clone: | 1B2 |
Isotype: | IgG2b Kappa |
Gene id: | 9915 |
Gene name: | ARNT2 |
Gene alias: | KIAA0307|bHLHe1 |
Gene description: | aryl-hydrocarbon receptor nuclear translocator 2 |
Genbank accession: | NM_014862 |
Immunogen: | ARNT2 (NP_055677.3, 464 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQI |
Protein accession: | NP_055677.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009915-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009915-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009915-M03-9-20-1.jpg](http://www.abnova.com/application_image/H00009915-M03-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged ARNT2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |