Brand: | Abnova |
Reference: | H00009910-M05 |
Product name: | RABGAP1L monoclonal antibody (M05), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RABGAP1L. |
Clone: | 2D3 |
Isotype: | IgG1 Kappa |
Gene id: | 9910 |
Gene name: | RABGAP1L |
Gene alias: | DKFZp686E1450|HHL|TBC1D18 |
Gene description: | RAB GTPase activating protein 1-like |
Genbank accession: | NM_014857 |
Immunogen: | RABGAP1L (NP_055672.3, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT |
Protein accession: | NP_055672.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RABGAP1L monoclonal antibody (M05), clone 2D3. Western Blot analysis of RABGAP1L expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |