Brand: | Abnova |
Reference: | H00009874-M01 |
Product name: | TLK1 monoclonal antibody (M01), clone 4B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLK1. |
Clone: | 4B3 |
Isotype: | IgG3 Kappa |
Gene id: | 9874 |
Gene name: | TLK1 |
Gene alias: | KIAA0137|PKU-beta |
Gene description: | tousled-like kinase 1 |
Genbank accession: | BC032657 |
Immunogen: | TLK1 (AAH32657, 111 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ |
Protein accession: | AAH32657 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009874-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009874-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009874-M01-3-12-1-L.jpg](http://www.abnova.com/application_image/H00009874-M01-3-12-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to TLK1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |