Brand: | Abnova |
Reference: | H00009867-M01 |
Product name: | PJA2 monoclonal antibody (M01), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PJA2. |
Clone: | 1G11 |
Isotype: | IgG2a Kappa |
Gene id: | 9867 |
Gene name: | PJA2 |
Gene alias: | KIAA0438|Neurodap1|RNF131 |
Gene description: | praja ring finger 2 |
Genbank accession: | NM_014819 |
Immunogen: | PJA2 (NP_055634, 302 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA |
Protein accession: | NP_055634 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009867-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009867-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00009867-M01-9-21-1.jpg](http://www.abnova.com/application_image/H00009867-M01-9-21-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PJA2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |