Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00009861-M01 |
Product name: | PSMD6 monoclonal antibody (M01), clone 1C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMD6. |
Clone: | 1C1 |
Isotype: | IgG1 Kappa |
Gene id: | 9861 |
Gene name: | PSMD6 |
Gene alias: | KIAA0107|Rpn7|S10|SGA-113M|p44S10 |
Gene description: | proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Genbank accession: | NM_014814 |
Immunogen: | PSMD6 (NP_055629, 292 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM |
Protein accession: | NP_055629 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PSMD6 expression in transfected 293T cell line by PSMD6 monoclonal antibody (M01), clone 1C1. Lane 1: PSMD6 transfected lysate(45.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |