Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMD6 monoclonal antibody (M01), clone 1C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about PSMD6 monoclonal antibody (M01), clone 1C1
| Brand: | Abnova |
| Reference: | H00009861-M01 |
| Product name: | PSMD6 monoclonal antibody (M01), clone 1C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMD6. |
| Clone: | 1C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9861 |
| Gene name: | PSMD6 |
| Gene alias: | KIAA0107|Rpn7|S10|SGA-113M|p44S10 |
| Gene description: | proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
| Genbank accession: | NM_014814 |
| Immunogen: | PSMD6 (NP_055629, 292 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM |
| Protein accession: | NP_055629 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PSMD6 expression in transfected 293T cell line by PSMD6 monoclonal antibody (M01), clone 1C1. Lane 1: PSMD6 transfected lysate(45.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |