Brand: | Abnova |
Reference: | H00009852-M02 |
Product name: | EPM2AIP1 monoclonal antibody (M02), clone 5G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1. |
Clone: | 5G7 |
Isotype: | IgG2a Kappa |
Gene id: | 9852 |
Gene name: | EPM2AIP1 |
Gene alias: | FLJ11207|KIAA0766 |
Gene description: | EPM2A (laforin) interacting protein 1 |
Genbank accession: | NM_014805 |
Immunogen: | EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN |
Protein accession: | NP_055620 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | EPM2AIP1 monoclonal antibody (M02), clone 5G7. Western Blot analysis of EPM2AIP1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |