Brand: | Abnova |
Reference: | H00009843-M01 |
Product name: | HEPH monoclonal antibody (M01), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HEPH. |
Clone: | 2D3 |
Isotype: | IgG2a Kappa |
Gene id: | 9843 |
Gene name: | HEPH |
Gene alias: | CPL|KIAA0698 |
Gene description: | hephaestin |
Genbank accession: | NM_138737 |
Immunogen: | HEPH (NP_620074, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI |
Protein accession: | NP_620074 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HEPH is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |