SPATA2 monoclonal antibody (M01), clone 1F1 View larger

SPATA2 monoclonal antibody (M01), clone 1F1

H00009825-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPATA2 monoclonal antibody (M01), clone 1F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SPATA2 monoclonal antibody (M01), clone 1F1

Brand: Abnova
Reference: H00009825-M01
Product name: SPATA2 monoclonal antibody (M01), clone 1F1
Product description: Mouse monoclonal antibody raised against a partial recombinant SPATA2.
Clone: 1F1
Isotype: IgG2a Kappa
Gene id: 9825
Gene name: SPATA2
Gene alias: FLJ13167|KIAA0757|PD1|tamo
Gene description: spermatogenesis associated 2
Genbank accession: NM_006038
Immunogen: SPATA2 (NP_006029, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVY
Protein accession: NP_006029
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009825-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009825-M01-1-1-1.jpg
Application image note: SPATA2 monoclonal antibody (M01), clone 1F1 Western Blot analysis of SPATA2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Upregulated hPuf-A promotes breast cancer tumorigenesis.Fan CC, Lee LY, Yu MY, Tzen CY, Chou C, Chang MS
Tumour Biol. 2013 Apr 28.

Reviews

Buy SPATA2 monoclonal antibody (M01), clone 1F1 now

Add to cart