Brand: | Abnova |
Reference: | H00009818-M01 |
Product name: | NUPL1 monoclonal antibody (M01), clone 3G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUPL1. |
Clone: | 3G11 |
Isotype: | IgG2b Kappa |
Gene id: | 9818 |
Gene name: | NUPL1 |
Gene alias: | KIAA0410|PRO2463 |
Gene description: | nucleoporin like 1 |
Genbank accession: | NM_014089 |
Immunogen: | NUPL1 (NP_054808.1, 323 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK |
Protein accession: | NP_054808.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged NUPL1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |