Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00009815-M04 |
Product name: | GIT2 monoclonal antibody (M04), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GIT2. |
Clone: | 1B2 |
Isotype: | IgG1 Kappa |
Gene id: | 9815 |
Gene name: | GIT2 |
Gene alias: | CAT-2|DKFZp686G01261|KIAA0148|MGC760 |
Gene description: | G protein-coupled receptor kinase interacting ArfGAP 2 |
Genbank accession: | NM_014776 |
Immunogen: | GIT2 (NP_055591, 401 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA |
Protein accession: | NP_055591 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GIT2 expression in transfected 293T cell line by GIT2 monoclonal antibody (M04), clone 1B2. Lane 1: GIT2 transfected lysate (Predicted MW: 52.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |