RNF40 polyclonal antibody (A01) View larger

RNF40 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF40 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RNF40 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009810-A01
Product name: RNF40 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RNF40.
Gene id: 9810
Gene name: RNF40
Gene alias: BRE1B|DKFZp686K191|KIAA0661|MGC13051|RBP95|STARING
Gene description: ring finger protein 40
Genbank accession: NM_014771
Immunogen: RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
Protein accession: NP_055586
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009810-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF40 polyclonal antibody (A01) now

Add to cart