TOMM20 monoclonal antibody (M01), clone 4F3 View larger

TOMM20 monoclonal antibody (M01), clone 4F3

H00009804-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOMM20 monoclonal antibody (M01), clone 4F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TOMM20 monoclonal antibody (M01), clone 4F3

Brand: Abnova
Reference: H00009804-M01
Product name: TOMM20 monoclonal antibody (M01), clone 4F3
Product description: Mouse monoclonal antibody raised against a full length recombinant TOMM20.
Clone: 4F3
Isotype: IgG1 Kappa
Gene id: 9804
Gene name: TOMM20
Gene alias: KIAA0016|MAS20|MGC117367|MOM19|TOM20
Gene description: translocase of outer mitochondrial membrane 20 homolog (yeast)
Genbank accession: BC066335
Immunogen: TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Protein accession: AAH66335
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009804-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.69 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00009804-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia.Murmu RP, Martin E, Rastetter A, Esteves T, Muriel MP, El Hachimi KH, Denora PS, Dauphin A, Fernandez JC, Duyckaerts C, Brice A, Darios F, Stevanin G.
Mol Cell Neurosci. 2011 Apr 27. [Epub ahead of print]

Reviews

Buy TOMM20 monoclonal antibody (M01), clone 4F3 now

Add to cart