DAZAP2 monoclonal antibody (M06), clone 8G5 View larger

DAZAP2 monoclonal antibody (M06), clone 8G5

H00009802-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DAZAP2 monoclonal antibody (M06), clone 8G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about DAZAP2 monoclonal antibody (M06), clone 8G5

Brand: Abnova
Reference: H00009802-M06
Product name: DAZAP2 monoclonal antibody (M06), clone 8G5
Product description: Mouse monoclonal antibody raised against a full-length recombinant DAZAP2.
Clone: 8G5
Isotype: IgG2a Kappa
Gene id: 9802
Gene name: DAZAP2
Gene alias: KIAA0058|MGC14319|MGC766|PRTB
Gene description: DAZ associated protein 2
Genbank accession: NM_014764.2
Immunogen: DAZAP2 (NP_055579.1, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Protein accession: NP_055579.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009802-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009802-M06-13-15-1.jpg
Application image note: Western Blot analysis of DAZAP2 expression in transfected 293T cell line by DAZAP2 monoclonal antibody (M06), clone 8G5.

Lane 1: DAZAP2 transfected lysate (Predicted MW: 17.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DAZAP2 monoclonal antibody (M06), clone 8G5 now

Add to cart