Brand: | Abnova |
Reference: | H00009785-M02 |
Product name: | DHX38 monoclonal antibody (M02), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DHX38. |
Clone: | 3B9 |
Isotype: | IgG2a Kappa |
Gene id: | 9785 |
Gene name: | DHX38 |
Gene alias: | DDX38|KIAA0224|PRP16|PRPF16 |
Gene description: | DEAH (Asp-Glu-Ala-His) box polypeptide 38 |
Genbank accession: | NM_014003 |
Immunogen: | DHX38 (NP_054722.2, 342 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQT |
Protein accession: | NP_054722.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DHX38 monoclonal antibody (M02), clone 3B9. Western Blot analysis of DHX38 expression in Hela S3 NE. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |