No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00009781-B02P |
Product name: | RNF144A purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human RNF144A protein. |
Gene id: | 9781 |
Gene name: | RNF144A |
Gene alias: | KIAA0161|RNF144|UBCE7IP4 |
Gene description: | ring finger protein 144A |
Genbank accession: | NM_014746.2 |
Immunogen: | RNF144A (NP_055561.2, 1 a.a. ~ 292 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT |
Protein accession: | NP_055561.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of RNF144A expression in transfected 293T cell line (H00009781-T02) by RNF144A MaxPab polyclonal antibody. Lane 1: RNF144 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |