View larger

KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00009768-B01P
Product name:	KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human KIAA0101 protein.
Gene id:	9768
Gene name:	KIAA0101
Gene alias:	L5\|NS5ATP9\|OEATC-1\|OEATC1\|PAF\|p15(PAF)
Gene description:	KIAA0101
Genbank accession:	NM_014736.4
Immunogen:	KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Protein accession:	NP_055551.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of KIAA0101 expression in transfected 293T cell line (H00009768-T01) by KIAA0101 MaxPab polyclonal antibody. Lane 1: KIAA0101 transfected lysate(12.32 KDa). Lane 2: Non-transfected lysate.
Applications:	IF,WB-Tr
Shipping condition:	Dry Ice